Catalog Number:
E13-006-1Amount:
10μgBackground:
EGF (epidermal growth factor) is a mitogenic polypeptide with 53 amino acid residues and three intramolecular disulfide bonds. EGF plays an important role in the regulation of cell growth, proliferation, and differentiation. EGF can promote wound healing and organogenesis. EGF is commonly used as a supplement in serum-free or reduced serum media for culture of mammalian cells. EGF is applicable to cosmetics such as whitening and crinkle prevention.Gene ID:
NP_P01133Amino acid sequence:
MGSSHHHHHHSSGLVPRGSHMENLYFQGMNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRForm of Antibody:
Lyophilized from a 0.22μm filtered solution at a concentration of 1mg/ml in 20mM Tris-HCl, pH8.0, 150mM NaCl.Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/ml.Shipping&Stablity:
The Product is shipped at ambient temperature. Upon reconstitution, the preparation is stable for up to 1 month at 2-8°C. For long term storage, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Price:
25$Research Area:
Stem Cells Cancer Cardiovascular Cell Biology Epigenetics & Nuclear Signaling Developmental Biologys Immunology Drug Discovery Products Metabolism Neuroscience Signal Transduction