You are here: EnoGene Home > Products > Recombinant Proteins > IL-1 β

IL-1 βPDF

  • Catalog Number:

    E13-003-1
  • Amount:

    10μg
  • Background:

    IL1 is a name that designates two pleiotropic cytokines, IL-1α (IL1-F1) and IL-1β (IL-1F2), which are the products of distinct genes. IL-1α and IL-1β are structurally related polypeptides that share approximately 21% amino acid (aa) identity in human. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1α and IL-1β are regulated independently, they bind to the same receptor and exert identical biological effects.
  • Gene ID:

    NP_000567
  • Amino acid sequence:

    GAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
  • Activity:

    ELISA to measure Il-1 binding activity (Figure B). IL-1 was immobilized on the plate and was detected by anti IL-1 β antibody (Abcam ab2105 ).
  • Form of Antibody:

    Lyophilized from a 0.22μm filtered solution at a concentration of 1mg/ml in 100mM Tris-HCl, pH8.0, 100mM NaCl, 1mM DTT.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/ml.
  • Shipping&Stablity:

    The Product is shipped at ambient temperature. Upon reconstitution, the preparation is stable for up to 1 month at 2-8°C. For long term storage, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
  • Price:

    125$
  • Research Area:

    Stem Cells Cancer Cardiovascular Cell Biology Epigenetics & Nuclear Signaling Developmental Biologys Immunology Drug Discovery Products Metabolism Neuroscience Signal Transduction

Related Products

His-SDF-1 βPDF
  • Catalog Number:

    E13-001-1
  • Amount:

    10μg
  • Reactivity:

  • Applications:

  • Swiss-Prot No.:

  • Price:

    125.00$
His-SDF-1 βPDF
  • Catalog Number:

    E13-001-2
  • Amount:

    50μg
  • Reactivity:

  • Applications:

  • Swiss-Prot No.:

  • Price:

    400.00$
SDF-1 βPDF
  • Catalog Number:

    E13-002-1
  • Amount:

    10μg
  • Reactivity:

  • Applications:

  • Swiss-Prot No.:

  • Price:

    125.00$
SDF-1 βPDF
  • Catalog Number:

    E13-002-2
  • Amount:

    50μg
  • Reactivity:

  • Applications:

  • Swiss-Prot No.:

  • Price:

    400.00$

Catalog Number

  • Amount:10μg
  • Price:125.00$

AbPromise