You are here: EnoGene Home > Products > Recombinant Proteins > SDF-1 α

SDF-1 αPDF

  • Catalog Number:

    E13-004-2
  • Amount:

    50μg
  • Background:

    SDF-1 (stromal cell-derived factor-1), also called CXCL12, is small cytokine belonging to the chemokine family. The two forms, SDF-1 α/CXCL12a and SDF-1 β/CXCL12b, are produced in cells by alternate splicing of the same gene. SDF-1 signal throμgh its receptor CXCR4, and have been shown to chemoattract B and T cells, induce migration of CD34+ stem cells. Additionally, SDF-1 and its receptor CXCR4 are involved in human disease states (e.g. HIV/AIDS) and cancer metastasis.
  • Gene ID:

    NP_954637
  • Amino acid sequence:

    MGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
  • Activity:

    ELISA to measure SDF-1α binding activity (Figure B). SDF-1αwas immobilized on the plate and was detected by anti SDF-1α antibody (Santacruz sc-6193 ).
  • Form of Antibody:

    Lyophilized from a 0.22μm filtered solution at a concentration of 1mg/ml in PBS.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/ml.
  • Shipping&Stablity:

    The Product is shipped at ambient temperature. Upon reconstitution, the preparation is stable for up to 1 month at 2-8°C. For long term storage, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
  • Price:

    400$
  • Research Area:

    Stem Cells Cancer Cardiovascular Cell Biology Epigenetics & Nuclear Signaling Developmental Biologys Immunology Drug Discovery Products Metabolism Neuroscience Signal Transduction

Related Products

His-SDF-1 βPDF
  • Catalog Number:

    E13-001-1
  • Amount:

    10μg
  • Reactivity:

  • Applications:

  • Swiss-Prot No.:

  • Price:

    125.00$
His-SDF-1 βPDF
  • Catalog Number:

    E13-001-2
  • Amount:

    50μg
  • Reactivity:

  • Applications:

  • Swiss-Prot No.:

  • Price:

    400.00$
SDF-1 βPDF
  • Catalog Number:

    E13-002-1
  • Amount:

    10μg
  • Reactivity:

  • Applications:

  • Swiss-Prot No.:

  • Price:

    125.00$
SDF-1 βPDF
  • Catalog Number:

    E13-002-2
  • Amount:

    50μg
  • Reactivity:

  • Applications:

  • Swiss-Prot No.:

  • Price:

    400.00$
IL-1 βPDF
  • Catalog Number:

    E13-003-1
  • Amount:

    10μg
  • Reactivity:

  • Applications:

  • Swiss-Prot No.:

  • Price:

    125.00$

Catalog Number

  • Amount:50μg
  • Price:400.00$

AbPromise